PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00020g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 196aa    MW: 22356.5 Da    PI: 4.8619
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00020g00008.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF45.21.2e-14746746
                              HHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
                    SRF-TF  7 snrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                              s r+v + +  + ++KKA+ELSvLCd+ va+iifs++ k+
  Peinf101Scf00020g00008.1  7 SERNVLLHRKVANLFKKAQELSVLCDVAVAIIIFSPDEKI 46
                              5677777777799***********************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.9E-4152IPR002100Transcription factor, MADS-box
PfamPF003193.7E-13746IPR002100Transcription factor, MADS-box
PROSITE profilePS5006612.741746IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-15885IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-51530IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-53051IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MASNTVSERN VLLHRKVANL FKKAQELSVL CDVAVAIIIF SPDEKIPIMW PSETKVRQIL  60
TSYLGRSEYQ RTKKLVLHEN YLREKLECKA EEIRKMEEKV EMEFLFNQLV MGMSIYDLDA  120
EQLRGLIKLA TLKKAKVEER KQQLEEERMK QLNENDVQPV EPPVAGGESG AGPEPAEGAN  180
NNAGEEKDDE HTKDSD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ1685130.0FJ168513.1 Petunia x hybrida type I MADS box transcription factor (MADSy8) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB6DT651e-127B6DT65_PETHY; Type I MADS box transcription factor (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37820129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06500.16e-15AGAMOUS-like 96